PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619618.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 508aa    MW: 57547.7 Da    PI: 6.6471
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619618.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3367.32.7e-112403951354
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel+++ wkd+++lk+lke++k+  +++          k  e + ++ m +aQDgiLkYM k me c+aqGfvYgi+ e+gk+v+g+sd+Lr+WW
  XP_013619618.1  40 EELERKIWKDKQRLKQLKEMSKNGSGKRLL--------KHPEDSTKRMMYQAQDGILKYMSKAMERCKAQGFVYGIVFENGKTVTGSSDNLREWW 126
                     8**************999999986544433........6789999************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--T CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgessl..qtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglsk 188
                     k+ v+fdrngpaai  +q + ++++++s+l  +  ++ + h+l elqDTtlg+LLsalm  c+ppqrr+ple+g++pPWWPtGke+ww+ l+l++
  XP_013619618.1 127 KDRVRFDRNGPAAILRHQRQINLSTDGSELggSEGGECTAHKLLELQDTTLGALLSALMPNCTPPQRRYPLERGLSPPWWPTGKEDWWNDLSLPE 221
                     ********************99999999996444466789******************************************************* PP

                     T--...-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX..........XXXXXX CS
            EIN3 189 dqg..tppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss..........slrkqs 271
                     d +  +ppykkphdlkk+wkv+vL + i+hm+ +i++i +l+r+s++lq+km+++e   +l+ lnqe++ +++ + ++              +++
  XP_013619618.1 222 DCRglPPPYKKPHDLKKVWKVGVLISIIRHMASEIDNIPKLVRRSRSLQEKMTSREGSLWLAALNQEKSNVDQSQYNPLafsgesnanaLGASGE 316
                     *********************************************************************99998888443444544543223377 PP

                     XXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXXX CS
            EIN3 272 pkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqney 354
                     ++v ++++ +++ve+   s+ +hv +v +  +f+ v+ ++k ++   + + ++   tc++s +++s+++++f+d+  ++++++
  XP_013619618.1 317 TDVLFQESGDYNVEEAYGSH-QHVPEVAN--NFNYVNNKRKFEGLGLSFHPTR-NLTCENSYCPYSQPHMGFNDRVLRDSHQM 395
                     78888888888888777777.67766665..8998888876666677777775.69************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.7E-10740289No hitNo description
Gene3DG3DSA:1.10.3180.101.7E-59162295IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.88E-52166291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MFNNNTEMFS GLVSNPERDV GPASLTAVCD DLTNQDIEIE ELERKIWKDK QRLKQLKEMS  60
KNGSGKRLLK HPEDSTKRMM YQAQDGILKY MSKAMERCKA QGFVYGIVFE NGKTVTGSSD  120
NLREWWKDRV RFDRNGPAAI LRHQRQINLS TDGSELGGSE GGECTAHKLL ELQDTTLGAL  180
LSALMPNCTP PQRRYPLERG LSPPWWPTGK EDWWNDLSLP EDCRGLPPPY KKPHDLKKVW  240
KVGVLISIIR HMASEIDNIP KLVRRSRSLQ EKMTSREGSL WLAALNQEKS NVDQSQYNPL  300
AFSGESNANA LGASGETDVL FQESGDYNVE EAYGSHQHVP EVANNFNYVN NKRKFEGLGL  360
SFHPTRNLTC ENSYCPYSQP HMGFNDRVLR DSHQMTCPYK TISCYQPTKP LGMPISFMTP  420
YQMEMQQQEQ FNLSSTLYRP KAVERGGNND YLSDHRFGLI DNSSPSTSGM NHNPGLVLPV  480
NFNGNAETVG MENNQQNQEG GLPMPWIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A9e-521652902125Protein ETHYLENE INSENSITIVE 3
4zds_B9e-521652902125Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619618.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 2 protein
SwissprotO231150.0EIL2_ARATH; ETHYLENE INSENSITIVE 3-like 2 protein
TrEMBLA0A0D3AKB70.0A0A0D3AKB7_BRAOL; Uncharacterized protein
STRINGAT5G21120.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147191621
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G21120.10.0ETHYLENE-INSENSITIVE3-like 2